SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2547_internal:A_BomaMSG_c10799_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_phosphatase_PP2A_55_kDa_regulatory_subunit_isoform_X3_[Bombyx_mori]
Ontology
GO:0000159 C protein phosphatase type 2A complex
GO:0000278 P mitotic cell cycle
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0004722 F protein serine/threonine phosphatase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005875 C microtubule associated complex
GO:0006470 P protein dephosphorylation
GO:0007091 P metaphase/anaphase transition of mitotic cell cycle
GO:0007099 P centriole replication
GO:0007406 P negative regulation of neuroblast proliferation
GO:0007423 P sensory organ development
GO:0007447 P imaginal disc pattern formation
GO:0008601 F protein phosphatase regulator activity
GO:0016055 P Wnt signaling pathway
GO:0030071 P regulation of mitotic metaphase/anaphase transition
GO:0034047 P regulation of phosphoprotein phosphatase activity
GO:0045201 P maintenance of neuroblast polarity
GO:0050821 P protein stabilization
GO:0051297 P centrosome cycle
RNA-seq EntryA_BomaMSG_c10799_g1_i1
Sequence
(Amino Acid)
SSDLEEPEDPHARSFFSEIISSISDVKLSNSGRYMMSRDYLGLKVWDLRMETKPVETYPV
HEYLRSKLCSLYENDCIFDKFECCWSGDDQRLMTGSYNGFFRIFERGCGAGRRG
(37 a.a.)

- SilkBase 1999-2023 -