SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2530_3prime_partial:A_BomaMSG_c10755_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		neuropeptide_receptor_A11_[Bombyx_mori]
Ontology
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007218 P neuropeptide signaling pathway
GO:0007268 P chemical synaptic transmission
GO:0008188 F neuropeptide receptor activity
GO:0009582 P detection of abiotic stimulus
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0031628 F opioid receptor binding
GO:0032870 P cellular response to hormone stimulus
GO:0042277 F peptide binding
GO:0043408 P regulation of MAPK cascade
GO:0045761 P regulation of adenylate cyclase activity
GO:1901652 P response to peptide
GO:2000479 P regulation of cAMP-dependent protein kinase activity
RNA-seq EntryA_BomaMSG_c10755_g1_i1
Sequence
(Amino Acid)
MFGNDTLQDVMASTIAAKYEPAMSLNGTTYVGGGVLILTRTLTGESVEMIDEPKTNKTID
IIDVKLVQVAFCILYTIIFVLGVFGNVLVCYVVFRNKAMQTVTNLFITNLALSDILLCVF
AVPL
(40 a.a.)

- SilkBase 1999-2023 -