SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2495_internal:A_BomaMSG_c10672_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
protein_O-GlcNAcase_[Bombyx_mori]
Ontology
GO:0004402 F histone acetyltransferase activity
GO:0004563 F beta-N-acetylhexosaminidase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006044 P N-acetylglucosamine metabolic process
GO:0006612 P protein targeting to membrane
GO:0007568 P aging
GO:0008152 P metabolic process
GO:0010524 P positive regulation of calcium ion transport into cytosol
GO:0010616 P negative regulation of cardiac muscle adaptation
GO:0016231 F beta-N-acetylglucosaminidase activity
GO:0016573 P histone acetylation
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0031343 P positive regulation of cell killing
GO:0032024 P positive regulation of insulin secretion
GO:0043243 P positive regulation of protein-containing complex disassembly
GO:0045862 P positive regulation of proteolysis
GO:0046060 P dATP metabolic process
GO:0046326 P positive regulation of glucose import
GO:0048545 P response to steroid hormone
GO:0051054 P positive regulation of DNA metabolic process
GO:0051901 P positive regulation of mitochondrial depolarization
GO:0051928 P positive regulation of calcium ion transport
GO:0060051 P negative regulation of protein glycosylation
GO:0060124 P positive regulation of growth hormone secretion
GO:0070265 P necrotic cell death
RNA-seq EntryA_BomaMSG_c10672_g1_i1
Sequence
(Amino Acid)
PNPIIPIASSNISLPSEIPVSTLPVPILGLKSLDDTIKIPSVSEAVLNPSVVESDSFAEE
NKKEEEDNIVVDDVEPSIEVQQNGDMSVGDTPQTLSPTRAVPEPGIEPLDVDPPSNTGTD
PDVVMTDGLSENGSMQVEASNSPLSSDMMVEPPDTTENTDEPEDNEDLTAEDLLLLCEAF
YLPFEHGARALRMLHDFHWLTSHAA
(67 a.a.)

- SilkBase 1999-2023 -