SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG2380_complete:A_BomaMSG_c10458_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
Mn_superoxide_dismutase_[Bombyx_mori]
Ontology
GO:0000302 P response to reactive oxygen species
GO:0000303 P response to superoxide
GO:0001306 P age-dependent response to oxidative stress
GO:0001315 P age-dependent response to reactive oxygen species
GO:0001666 P response to hypoxia
GO:0001836 P release of cytochrome c from mitochondria
GO:0001889 P liver development
GO:0003032 P detection of oxygen
GO:0003069 P acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure
GO:0003677 F DNA binding
GO:0004784 F superoxide dismutase activity
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005759 C mitochondrial matrix
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006749 P glutathione metabolic process
GO:0006801 P superoxide metabolic process
GO:0006979 P response to oxidative stress
GO:0007005 P mitochondrion organization
GO:0007507 P heart development
GO:0007568 P aging
GO:0007626 P locomotory behavior
GO:0008217 P regulation of blood pressure
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0008631 P intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0008637 P apoptotic mitochondrial changes
GO:0009314 P response to radiation
GO:0009409 P response to cold
GO:0009791 P post-embryonic development
GO:0010042 P response to manganese ion
GO:0010043 P response to zinc ion
GO:0010269 P response to selenium ion
GO:0010332 P response to gamma radiation
GO:0014823 P response to activity
GO:0016491 F oxidoreductase activity
GO:0019430 P removal of superoxide radicals
GO:0019825 F oxygen binding
GO:0019899 F enzyme binding
GO:0022904 P respiratory electron transport chain
GO:0030097 P hemopoiesis
GO:0030145 F manganese ion binding
GO:0031667 P response to nutrient levels
GO:0032496 P response to lipopolysaccharide
GO:0033591 P response to L-ascorbic acid
GO:0034021 P response to silicon dioxide
GO:0035900 P response to isolation stress
GO:0035902 P response to immobilization stress
GO:0042311 P vasodilation
GO:0042493 P response to xenobiotic stimulus
GO:0042542 P response to hydrogen peroxide
GO:0042554 P superoxide anion generation
GO:0042645 C mitochondrial nucleoid
GO:0042743 P hydrogen peroxide metabolic process
GO:0042802 F identical protein binding
GO:0043066 P negative regulation of apoptotic process
GO:0043209 C myelin sheath
GO:0045429 P positive regulation of nitric oxide biosynthetic process
GO:0045599 P negative regulation of fat cell differentiation
GO:0046686 P response to cadmium ion
GO:0046872 F metal ion binding
GO:0048147 P negative regulation of fibroblast proliferation
GO:0048666 P neuron development
GO:0048678 P response to axon injury
GO:0048773 P erythrophore differentiation
GO:0050665 P hydrogen peroxide biosynthetic process
GO:0050790 P regulation of catalytic activity
GO:0051260 P protein homooligomerization
GO:0051602 P response to electrical stimulus
GO:0051881 P regulation of mitochondrial membrane potential
GO:0055072 P iron ion homeostasis
GO:0055093 P response to hyperoxia
GO:0055114 P obsolete oxidation-reduction process
GO:0071000 P response to magnetism
GO:0071361 P cellular response to ethanol
RNA-seq EntryA_BomaMSG_c10458_g1_i1
Sequence
(Amino Acid)
MLMSQRIGSLIRVAGASRQKHTLPELPYEYNALEPVISREIMSLHHSKHHATYINNLNVA
EEKLAQAQAKGDIDTIINLAPALKFNGGGHINHSIFWHNLSPNGGKPSDVLTKAVEKDFG
SWDNLKNQLSTASVAVQGSGWGWLGYNKQMKKLQIATCQNQDPLQATTGLVPLFGIDVWE
HAYYLQYKNVRADYVKAIFDVANWNDISQRYEKALK
*(71 a.a.)

- SilkBase 1999-2023 -