SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG237_internal:A_BomaMSG_c1058_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
zinc_finger_protein_62_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0017053 C transcription repressor complex
GO:0019827 P stem cell population maintenance
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0030512 P negative regulation of transforming growth factor beta receptor signaling pathway
GO:0030853 P negative regulation of granulocyte differentiation
GO:0033613 F DNA-binding transcription factor binding
GO:0035019 P somatic stem cell population maintenance
GO:0043457 P regulation of cellular respiration
GO:0043565 F sequence-specific DNA binding
GO:0043586 P tongue development
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046332 F SMAD binding
GO:0046872 F metal ion binding
GO:0050872 P white fat cell differentiation
GO:0050873 P brown fat cell differentiation
GO:0060021 P roof of mouth development
GO:0090336 P positive regulation of brown fat cell differentiation
RNA-seq EntryA_BomaMSG_c1058_g1_i1
Sequence
(Amino Acid)
CALPIWKLFCNKYSLAVHLREHSEHVGKRYECDDCGLKYYTRRSIVRHITSAHLGGATEH
KCSRCDKIFATAHHKRRHMRLKHESKKMPRDKICEICARSFTSSKMLKAQIGR
(36 a.a.)

- SilkBase 1999-2023 -