| Name | O_BomaMSG2333_internal:A_BomaMSG_c10374_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | dnaJ_homolog_subfamily_C_member_13_isoform_X3_[Bombyx_mori] |
| Ontology |
| GO:0001649 |
P |
osteoblast differentiation |
| GO:0005515 |
F |
protein binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005765 |
C |
lysosomal membrane |
| GO:0005768 |
C |
endosome |
| GO:0005769 |
C |
early endosome |
| GO:0006810 |
P |
transport |
| GO:0007032 |
P |
endosome organization |
| GO:0010008 |
C |
endosome membrane |
| GO:0015031 |
P |
protein transport |
| GO:0016020 |
C |
membrane |
| GO:0031901 |
C |
early endosome membrane |
| GO:0043231 |
C |
intracellular membrane-bounded organelle |
| GO:0070062 |
C |
extracellular exosome |
| GO:0071203 |
C |
WASH complex |
| GO:1902954 |
P |
regulation of early endosome to recycling endosome transport |
| GO:2000641 |
P |
regulation of early endosome to late endosome transport |
|
| RNA-seq Entry | A_BomaMSG_c10374_g1_i1 |
Sequence
(Amino Acid) | GGALLPAACELAHATLCCSALNAEELRREQGLEVLQEALARCVPLLGSATSAQDPLAAVC
AHCARCFAVAATFPACRERCALMTQLCMDIVPLLKRPNRSEER
(33 a.a.) |
