SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2321_internal:A_BomaMSG_c10355_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		protein_mothers_against_dpp_[Bombyx_mori]
Ontology
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001102 F RNA polymerase II-specific DNA-binding transcription factor binding
GO:0001105 F transcription coactivator activity
GO:0001745 P compound eye morphogenesis
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003705 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005634 C nucleus
GO:0005667 C transcription regulator complex
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007179 P transforming growth factor beta receptor signaling pathway
GO:0007275 P multicellular organism development
GO:0007391 P dorsal closure
GO:0007419 P ventral cord development
GO:0007424 P open tracheal system development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007488 P histoblast morphogenesis
GO:0007507 P heart development
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0010629 P negative regulation of gene expression
GO:0030618 F obsolete transforming growth factor beta receptor, pathway-specific cytoplasmic mediator activity
GO:0030707 P ovarian follicle cell development
GO:0030718 P germ-line stem cell population maintenance
GO:0035019 P somatic stem cell population maintenance
GO:0035290 P trunk segmentation
GO:0042078 P germ-line stem cell division
GO:0043565 F sequence-specific DNA binding
GO:0045595 P regulation of cell differentiation
GO:0045705 P negative regulation of salivary gland boundary specification
GO:0045887 P positive regulation of synaptic assembly at neuromuscular junction
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0048100 P wing disc anterior/posterior pattern formation
GO:0050803 P regulation of synapse structure or activity
GO:0060799 P transforming growth factor beta receptor signaling pathway involved in endodermal cell fate specification
GO:0061353 P BMP signaling pathway involved in Malpighian tubule cell chemotaxis
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_BomaMSG_c10355_g1_i1
Sequence
(Amino Acid)
PAVKKLLGWKQGDEEEKWAEKAVDSLVKKLKKRKGAVEELERALSCPGTPSKCVTIPRSL
DGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLEICQFPFSAKQKEVCINPYHYKRVE
SPVLPPVLVPRHSEFAPGHSLLPFQRTAEPSMPHNVSYSGSGFPPSASSELPDTPPPAYS
PPSEDSEPPGEVAPVSYQEPLYWASVAYYELNCRVGEVFHCNSHSVVVDGFTDPSNNSDR
FCLGQLSNVNRNSTIENTRRHIGKGVHLYYVG
(89 a.a.)

- SilkBase 1999-2023 -