SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2313_complete:A_BomaMSG_c10302_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		autophagy_related_protein_Atg8_[Bombyx_mori]
Ontology
GO:0000045 P autophagosome assembly
GO:0000139 C Golgi membrane
GO:0000226 P microtubule cytoskeleton organization
GO:0000421 C autophagosome membrane
GO:0000422 P autophagy of mitochondrion
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005776 C autophagosome
GO:0005790 C smooth endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0005886 C plasma membrane
GO:0005930 C axoneme
GO:0006810 P transport
GO:0006914 P autophagy
GO:0006915 P apoptotic process
GO:0006995 P cellular response to nitrogen starvation
GO:0008017 F microtubule binding
GO:0008625 P extrinsic apoptotic signaling pathway via death domain receptors
GO:0012505 C endomembrane system
GO:0015031 P protein transport
GO:0015629 C actin cytoskeleton
GO:0016020 C membrane
GO:0031410 C cytoplasmic vesicle
GO:0031625 F ubiquitin protein ligase binding
GO:0044297 C cell body
GO:0048471 C perinuclear region of cytoplasm
GO:0048487 F beta-tubulin binding
GO:0050811 F GABA receptor binding
GO:0097225 C sperm midpiece
RNA-seq EntryA_BomaMSG_c10302_g1_i1
Sequence
(Amino Acid)
MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN
*(38 a.a.)

- SilkBase 1999-2023 -