SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2274_3prime_partial:A_BomaMSG_c10250_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		sialin_[Helicoverpa_armigera]
Ontology
GO:0003407 P neural retina development
GO:0005313 F L-glutamate transmembrane transporter activity
GO:0005737 C cytoplasm
GO:0005771 C multivesicular body
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006814 P sodium ion transport
GO:0006836 P neurotransmitter transport
GO:0007420 P brain development
GO:0007605 P sensory perception of sound
GO:0015293 F symporter activity
GO:0015813 P L-glutamate transmembrane transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016023 C cytoplasmic vesicle
GO:0030054 C cell junction
GO:0030425 C dendrite
GO:0030672 C synaptic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0043005 C neuron projection
GO:0043025 C neuronal cell body
GO:0043204 C perikaryon
GO:0043679 C axon terminus
GO:0045202 C synapse
GO:0055085 P transmembrane transport
GO:0060076 C excitatory synapse
GO:0089711 P L-glutamate transmembrane transport
GO:0090102 P cochlea development
GO:0097440 C apical dendrite
GO:0097441 C basal dendrite
GO:0097451 C glial limiting end-foot
GO:1990030 C pericellular basket
RNA-seq EntryA_BomaMSG_c10250_g1_i1
Sequence
(Amino Acid)
MAKTEKSFPRNFTGCLTCVQVLNIMVLLGFMLNYALRVNLTIAIVEMIYDQKDNQTAVAN
ITNGTHHVTEHPGHIEQTRFFWDTKQKNLVLGCFFWGYVMTELPGGRLAEIIGARRVFGY
STLLASIL
(41 a.a.)

- SilkBase 1999-2023 -