SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2273_internal:A_BomaMSG_c10242_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		active_breakpoint_cluster_region-related_protein_isoform_X3_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0002692 P negative regulation of cellular extravasation
GO:0004674 F protein serine/threonine kinase activity
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0007165 P signal transduction
GO:0007420 P brain development
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019899 F enzyme binding
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0030336 P negative regulation of cell migration
GO:0032496 P response to lipopolysaccharide
GO:0035023 P regulation of Rho protein signal transduction
GO:0035556 P intracellular signal transduction
GO:0042472 P inner ear morphogenesis
GO:0043114 P regulation of vascular permeability
GO:0043234 C protein-containing complex
GO:0043314 P negative regulation of neutrophil degranulation
GO:0043547 P positive regulation of GTPase activity
GO:0045202 C synapse
GO:0045211 C postsynaptic membrane
GO:0046777 P protein autophosphorylation
GO:0048008 P platelet-derived growth factor receptor signaling pathway
GO:0050728 P negative regulation of inflammatory response
GO:0050766 P positive regulation of phagocytosis
GO:0050885 P neuromuscular process controlling balance
GO:0051726 P regulation of cell cycle
GO:0060313 P negative regulation of blood vessel remodeling
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomaMSG_c10242_g1_i1
Sequence
(Amino Acid)
KVSREWVTEGGVCRTVSLGGGNLPLRVRLLPPERSARRVPNAKPGALFGAKIAHVARREK
RNIPFIISACVREVERCGLHEVGVYRVSGSASDLNRLKKSFETNPYEAEQLLKEVDIHSV
TGVLKLYLRELPEALFTDALYPELLKAWGSVQGVGISVDSGPAHTRRHALLKCYAQLPDL
NKNCIDFLLNHFVKVNQHEGENKMSLHNLATVFGPTLLRPASGGGGAGGKQRSDPL
(77 a.a.)

- SilkBase 1999-2023 -