SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2265_internal:A_BomaMSG_c10225_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_tyrosine-protein_phosphatase_Lar-like_[Amyelois_transitella]
Ontology
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005001 F transmembrane receptor protein tyrosine phosphatase activity
GO:0005515 F protein binding
GO:0005875 C microtubule associated complex
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0006470 P protein dephosphorylation
GO:0007155 P cell adhesion
GO:0007283 P spermatogenesis
GO:0007399 P nervous system development
GO:0007411 P axon guidance
GO:0007412 P axon target recognition
GO:0008045 P motor neuron axon guidance
GO:0008201 F heparin binding
GO:0008360 P regulation of cell shape
GO:0008594 P photoreceptor cell morphogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0030424 C axon
GO:0031290 P retinal ganglion cell axon guidance
GO:0032093 F SAM domain binding
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0045467 P R7 cell development
GO:0048477 P oogenesis
GO:0048675 P axon extension
GO:0048841 P regulation of axon extension involved in axon guidance
GO:0051124 P synaptic assembly at neuromuscular junction
GO:1903386 P negative regulation of homophilic cell adhesion
RNA-seq EntryA_BomaMSG_c10225_g1_i1
Sequence
(Amino Acid)
VLFRSCEAASVLGVIEATAEVKVQSLPGAPTEVRPSEVTATAVRLSWTYNGPEEPQYYVI
QYKPKNAHQAFSEISGVITQYYSVTNLSPYTEYEMYVIAVNNIGRGPPSSPAVISTGETE
PGSAPKNVQVRPLSSSTMVIQWEEPETPNGQVTGYKIFYTTDPSQPLQSWHSHMMDNSHL
TTISELTPH
(62 a.a.)

- SilkBase 1999-2023 -