SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2246_internal:A_BomaMSG_c10093_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		bromodomain-containing_protein_7_[Bombyx_mori]
Ontology
GO:0002039 F p53 binding
GO:0003713 F transcription coactivator activity
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007049 P cell cycle
GO:0008134 F transcription factor binding
GO:0008285 P negative regulation of cell population proliferation
GO:0016055 P Wnt signaling pathway
GO:0035066 P positive regulation of histone acetylation
GO:0042393 F histone binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0070577 F lysine-acetylated histone binding
GO:0090544 C SWI/SNF superfamily-type complex
GO:2000134 P negative regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_BomaMSG_c10093_g1_i1
Sequence
(Amino Acid)
GKLNQGTGTLHTPREDRRNVAKGVKPLNYGPFSSYAPSYDGTFATLTKEESHLIYHTLPS
ETGLGNEEMLRFAPDSPWALLYDMEALFPDKKHAAETAPPLHDNELSKVKIDLEELRSLS
ALGVDVEFVAEAERAARDLGLGPALAH
(48 a.a.)

- SilkBase 1999-2023 -