SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2237_internal:A_BomaMSG_c10050_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		ubiquitin_carboxyl-terminal_hydrolase_20_isoform_X1_[Bombyx_mori]
Ontology
GO:0004197 F cysteine-type endopeptidase activity
GO:0004843 F thiol-dependent deubiquitinase
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006897 P endocytosis
GO:0007411 P axon guidance
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008270 F zinc ion binding
GO:0008277 P regulation of G protein-coupled receptor signaling pathway
GO:0016477 P cell migration
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0036459 F thiol-dependent deubiquitinase
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051298 P centrosome duplication
GO:0070536 P protein K63-linked deubiquitination
GO:0071108 P protein K48-linked deubiquitination
RNA-seq EntryA_BomaMSG_c10050_g1_i2
Sequence
(Amino Acid)
ASGGHYTCAVRAGAGWYSFDDHAVAPLHVHQLAAAEAYVLFYRKVNPQMAVLREKAAEIL
ESSNIGPNDPKYYISKQWINKFNTWAEPGPVDNSDFVCSHGEVRPDREPYLAALAVALPP
ALWDFL
(41 a.a.)

- SilkBase 1999-2023 -