SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG2234_internal:A_BomaMSG_c10033_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		prolyl_4-hydroxylase_alpha_subunit_precursor_[Bombyx_mori]
Ontology
GO:0004656 F procollagen-proline 4-dioxygenase activity
GO:0005506 F iron ion binding
GO:0005783 C endoplasmic reticulum
GO:0005788 C endoplasmic reticulum lumen
GO:0016491 F oxidoreductase activity
GO:0016702 F oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0016705 F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0019511 P peptidyl-proline hydroxylation
GO:0031418 F L-ascorbic acid binding
GO:0031545 F peptidyl-proline 4-dioxygenase activity
GO:0043412 P macromolecule modification
GO:0046872 F metal ion binding
GO:0051213 F dioxygenase activity
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomaMSG_c10033_g1_i1
Sequence
(Amino Acid)
VCSSDLYELGRALYNDKDYTNALAWMKEALRKYKDENVMYPFTEVDILEYIGFAYYLNGD
VKTALEWTQRLLSVDPKHVRARGNIPHYQKTIAEHEAELKKQQRGETSDEPEEIGR
(37 a.a.)

- SilkBase 1999-2023 -