SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG13400_internal:A_BomaMSG_c22991_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		bromodomain-containing_protein_DDB_G0280777-like_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001190 F obsolete transcriptional activator activity, RNA polymerase II transcription factor binding
GO:0001525 P angiogenesis
GO:0001669 C acrosomal vesicle
GO:0001701 P in utero embryonic development
GO:0001708 P cell fate specification
GO:0001726 C ruffle
GO:0001837 P epithelial to mesenchymal transition
GO:0001889 P liver development
GO:0001947 P heart looping
GO:0002040 P sprouting angiogenesis
GO:0002052 P positive regulation of neuroblast proliferation
GO:0002193 C MAML1-RBP-Jkappa- ICN1 complex
GO:0002437 P inflammatory response to antigenic stimulus
GO:0003157 P endocardium development
GO:0003160 P endocardium morphogenesis
GO:0003162 P atrioventricular node development
GO:0003169 P coronary vein morphogenesis
GO:0003180 P aortic valve morphogenesis
GO:0003181 P atrioventricular valve morphogenesis
GO:0003184 P pulmonary valve morphogenesis
GO:0003192 P mitral valve formation
GO:0003197 P endocardial cushion development
GO:0003198 P epithelial to mesenchymal transition involved in endocardial cushion formation
GO:0003203 P endocardial cushion morphogenesis
GO:0003207 P cardiac chamber formation
GO:0003208 P cardiac ventricle morphogenesis
GO:0003209 P cardiac atrium morphogenesis
GO:0003213 P cardiac right atrium morphogenesis
GO:0003214 P cardiac left ventricle morphogenesis
GO:0003219 P cardiac right ventricle formation
GO:0003222 P ventricular trabecula myocardium morphogenesis
GO:0003241 P growth involved in heart morphogenesis
GO:0003256 P regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation
GO:0003264 P regulation of cardioblast proliferation
GO:0003270 P Notch signaling pathway involved in regulation of secondary heart field cardioblast proliferation
GO:0003273 P cell migration involved in endocardial cushion formation
GO:0003344 P pericardium morphogenesis
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0004857 F enzyme inhibitor activity
GO:0004872 F signaling receptor activity
GO:0005112 F Notch binding
GO:0005509 F calcium ion binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005912 C adherens junction
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006959 P humoral immune response
GO:0007219 P Notch signaling pathway
GO:0007221 P positive regulation of transcription of Notch receptor target
GO:0007275 P multicellular organism development
GO:0007283 P spermatogenesis
GO:0007368 P determination of left/right symmetry
GO:0007386 P compartment pattern specification
GO:0007409 P axonogenesis
GO:0007420 P brain development
GO:0007440 P foregut morphogenesis
GO:0007492 P endoderm development
GO:0007507 P heart development
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0008544 P epidermis development
GO:0008593 P regulation of Notch signaling pathway
GO:0009912 P auditory receptor cell fate commitment
GO:0009986 C cell surface
GO:0010001 P glial cell differentiation
GO:0010468 P regulation of gene expression
GO:0010718 P positive regulation of epithelial to mesenchymal transition
GO:0010812 P negative regulation of cell-substrate adhesion
GO:0010832 P negative regulation of myotube differentiation
GO:0014031 P mesenchymal cell development
GO:0014807 P regulation of somitogenesis
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0019899 F enzyme binding
GO:0021515 P cell differentiation in spinal cord
GO:0021915 P neural tube development
GO:0030027 C lamellipodium
GO:0030154 P cell differentiation
GO:0030182 P neuron differentiation
GO:0030216 P keratinocyte differentiation
GO:0030279 P negative regulation of ossification
GO:0030324 P lung development
GO:0030326 P embryonic limb morphogenesis
GO:0030334 P regulation of cell migration
GO:0030335 P positive regulation of cell migration
GO:0030513 P positive regulation of BMP signaling pathway
GO:0030514 P negative regulation of BMP signaling pathway
GO:0030900 P forebrain development
GO:0031069 P hair follicle morphogenesis
GO:0031100 P animal organ regeneration
GO:0031410 C cytoplasmic vesicle
GO:0031490 F chromatin DNA binding
GO:0031960 P response to corticosteroid
GO:0032495 P response to muramyl dipeptide
GO:0032496 P response to lipopolysaccharide
GO:0035116 P embryonic hindlimb morphogenesis
GO:0035148 P tube formation
GO:0035914 P skeletal muscle cell differentiation
GO:0035924 P cellular response to vascular endothelial growth factor stimulus
GO:0042127 P regulation of cell population proliferation
GO:0042246 P tissue regeneration
GO:0043065 P positive regulation of apoptotic process
GO:0043086 P negative regulation of catalytic activity
GO:0043235 C receptor complex
GO:0043565 F sequence-specific DNA binding
GO:0045070 P positive regulation of viral genome replication
GO:0045165 P cell fate commitment
GO:0045596 P negative regulation of cell differentiation
GO:0045603 P positive regulation of endothelial cell differentiation
GO:0045607 P regulation of inner ear auditory receptor cell differentiation
GO:0045608 P negative regulation of inner ear auditory receptor cell differentiation
GO:0045618 P positive regulation of keratinocyte differentiation
GO:0045662 P negative regulation of myoblast differentiation
GO:0045665 P negative regulation of neuron differentiation
GO:0045668 P negative regulation of osteoblast differentiation
GO:0045687 P positive regulation of glial cell differentiation
GO:0045747 P positive regulation of Notch signaling pathway
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0045955 P negative regulation of calcium ion-dependent exocytosis
GO:0046427 P positive regulation of receptor signaling pathway via JAK-STAT
GO:0046533 P negative regulation of photoreceptor cell differentiation
GO:0046872 F metal ion binding
GO:0046982 F protein heterodimerization activity
GO:0048103 P somatic stem cell division
GO:0048663 P neuron fate commitment
GO:0048708 P astrocyte differentiation
GO:0048709 P oligodendrocyte differentiation
GO:0048711 P positive regulation of astrocyte differentiation
GO:0048715 P negative regulation of oligodendrocyte differentiation
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0050434 P positive regulation of viral transcription
GO:0050678 P regulation of epithelial cell proliferation
GO:0050679 P positive regulation of epithelial cell proliferation
GO:0050767 P regulation of neurogenesis
GO:0050768 P negative regulation of neurogenesis
GO:0050793 P regulation of developmental process
GO:0055008 P cardiac muscle tissue morphogenesis
GO:0060038 P cardiac muscle cell proliferation
GO:0060045 P positive regulation of cardiac muscle cell proliferation
GO:0060253 P negative regulation of glial cell proliferation
GO:0060271 P cilium assembly
GO:0060317 P cardiac epithelial to mesenchymal transition
GO:0060411 P cardiac septum morphogenesis
GO:0060412 P ventricular septum morphogenesis
GO:0060528 P secretory columnal luminar epithelial cell differentiation involved in prostate glandular acinus development
GO:0060548 P negative regulation of cell death
GO:0060740 P prostate gland epithelium morphogenesis
GO:0060768 P regulation of epithelial cell proliferation involved in prostate gland development
GO:0060842 P arterial endothelial cell differentiation
GO:0060843 P venous endothelial cell differentiation
GO:0060948 P cardiac vascular smooth muscle cell development
GO:0060956 P endocardial cell differentiation
GO:0060979 P vasculogenesis involved in coronary vascular morphogenesis
GO:0060982 P coronary artery morphogenesis
GO:0061314 P Notch signaling involved in heart development
GO:0061384 P heart trabecula morphogenesis
GO:0061419 P positive regulation of transcription from RNA polymerase II promoter in response to hypoxia
GO:0070986 P left/right axis specification
GO:0071372 P cellular response to follicle-stimulating hormone stimulus
GO:0071944 C cell periphery
GO:0072017 P distal tubule development
GO:0072044 P collecting duct development
GO:0072144 P glomerular mesangial cell development
GO:0072602 P interleukin-4 production
GO:0090051 P negative regulation of cell migration involved in sprouting angiogenesis
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0097150 P neuronal stem cell population maintenance
GO:1901201 P regulation of extracellular matrix assembly
GO:1902263 P apoptotic process involved in embryonic digit morphogenesis
GO:2000737 P negative regulation of stem cell differentiation
GO:2000811 P negative regulation of anoikis
GO:2000974 P negative regulation of pro-B cell differentiation
GO:2001027 P negative regulation of endothelial cell chemotaxis
RNA-seq EntryA_BomaMSG_c22991_g1_i2
Sequence
(Amino Acid)
SEERSEEELERYRAMMANINGHFQFMPGIVGVPALQHGLTPMQPGLAPILPGQPIHIIPN
MYNQFAMPQHVDPSAFGAQPMQGMPPQSMQSQGIQPQSMQSQGIQPQSMQPQGTTLQSMQ
SQAMQA
(41 a.a.)

- SilkBase 1999-2023 -