SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG13344_5prime_partial:A_BomaMSG_c22969_g1_i4
Scaffold_id
NCBI non-redundant
(nr)		phosphatidate_phosphatase_LPIN3_isoform_X1_[Bombyx_mori]
Ontology
GO:0003713 F transcription coactivator activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006646 P phosphatidylethanolamine biosynthetic process
GO:0006656 P phosphatidylcholine biosynthetic process
GO:0008195 F phosphatidate phosphatase activity
GO:0009062 P fatty acid catabolic process
GO:0016020 C membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0019432 P triglyceride biosynthetic process
GO:0045944 P positive regulation of transcription by RNA polymerase II
RNA-seq EntryA_BomaMSG_c22969_g1_i4
Sequence
(Amino Acid)
VVMLLINNVYCYLIIYQDVCAYQAVGIPIVRIFTINYKGELKHELTQTFQSTYSHMSVLV
DQVFPPAQCEPSDEFSQTVYWRDPLPAVDLPPIVPPQPKH
*(32 a.a.)

- SilkBase 1999-2023 -