SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG13340_complete:A_BomaMSG_c22968_g1_i4
Scaffold_id
NCBI non-redundant
(nr)		tyrosine-protein_phosphatase_corkscrew_isoform_X1_[Bombyx_mori]
Ontology
GO:0001784 F phosphotyrosine residue binding
GO:0002244 P hematopoietic progenitor cell differentiation
GO:0002924 P negative regulation of humoral immune response mediated by circulating immunoglobulin
GO:0004721 F phosphoprotein phosphatase activity
GO:0004725 F protein tyrosine phosphatase activity
GO:0005001 F transmembrane receptor protein tyrosine phosphatase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005911 C cell-cell junction
GO:0006470 P protein dephosphorylation
GO:0006915 P apoptotic process
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0008283 P cell population proliferation
GO:0008284 P positive regulation of cell population proliferation
GO:0008285 P negative regulation of cell population proliferation
GO:0014068 P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0016311 P dephosphorylation
GO:0016787 F hydrolase activity
GO:0016791 F phosphatase activity
GO:0017124 F SH3 domain binding
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0030154 P cell differentiation
GO:0030168 P platelet activation
GO:0030220 P platelet formation
GO:0031295 P T cell costimulation
GO:0033277 P abortive mitotic cell cycle
GO:0033630 P positive regulation of cell adhesion mediated by integrin
GO:0035335 P peptidyl-tyrosine dephosphorylation
GO:0035556 P intracellular signal transduction
GO:0035855 P megakaryocyte development
GO:0042105 C alpha-beta T cell receptor complex
GO:0042130 P negative regulation of T cell proliferation
GO:0042169 F SH2 domain binding
GO:0042267 P natural killer cell mediated cytotoxicity
GO:0043407 P negative regulation of MAP kinase activity
GO:0043409 P negative regulation of MAPK cascade
GO:0045577 P regulation of B cell differentiation
GO:0050732 P negative regulation of peptidyl-tyrosine phosphorylation
GO:0050853 P B cell receptor signaling pathway
GO:0050859 P negative regulation of B cell receptor signaling pathway
GO:0050860 P negative regulation of T cell receptor signaling pathway
GO:0050900 P leukocyte migration
GO:0051279 P regulation of release of sequestered calcium ion into cytosol
GO:0060338 P regulation of type I interferon-mediated signaling pathway
GO:0070062 C extracellular exosome
GO:0070372 P regulation of ERK1 and ERK2 cascade
GO:0070527 P platelet aggregation
GO:2000045 P regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_BomaMSG_c22968_g1_i4
Sequence
(Amino Acid)
MSKDNPRLSRLGVLAPAALSACMDASVLAVPAAGAIVSTVLKELSKAFMLKKWFHGVMSA
KEAESLIMEKGKNGSFLVRESQAHPGEYVLSVRVRGRVSHVLIRRQHNKYDVGSGEQFDD
LVGLIEHFRSYPMIETSGDVLRLLQPVSGTRLRAHDIDQKVQEMQGIEDRQKMECNTGFD
GEFQSLKLLEDRHVFTTIEGMKPENVSKNRYRNVLPYDQTRVVLRRRDNKLESDYINASF
VRSSRLSDSTSSVQSSNESLDSVQSLILNTEKKKAVPLVTKSLSDDALREMKKSLKLDKI
NGNLNKDAVKDKIYIAAQGCLPSTKDDFWRMIWQEDVRVIAMITNEHEKGKRKCVRYWPL
SGQEERYDNLLVRSISESHYEDYLIRELDVCDENKCCRAVYQYQFTAWPDHSTPPEPDRI
ISFMEDINRRMFLVTQEKNAPDQNVICVHCSAGVGRTGTFIVLDILLDKIKSSGENK
*(158 a.a.)

- SilkBase 1999-2023 -