SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG129_internal:A_BomaMSG_c615_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		cholinesterase_1_[Bombyx_mori]
Ontology
GO:0004872 F signaling receptor activity
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005887 C integral component of plasma membrane
GO:0007158 P neuron cell-cell adhesion
GO:0007416 P synapse assembly
GO:0007618 P mating
GO:0007619 P courtship behavior
GO:0009986 C cell surface
GO:0016787 F hydrolase activity
GO:0019953 P sexual reproduction
GO:0030728 P ovulation
GO:0032504 P multicellular organism reproduction
GO:0042043 F neurexin family protein binding
GO:0042811 P pheromone biosynthetic process
GO:0045202 C synapse
GO:0046008 P regulation of female receptivity, post-mating
GO:0046662 P regulation of oviposition
GO:0046692 P sperm competition
GO:0046693 P sperm storage
GO:0050804 P modulation of chemical synaptic transmission
GO:0052689 F carboxylic ester hydrolase activity
RNA-seq EntryA_BomaMSG_c615_g1_i1
Sequence
(Amino Acid)
SIGMKWLALLSLIAVSVVRLPAPVVITTSGPVRGRISENGNFYEYFGIPYATVDERNRFQ
APLPAPQWSDIFEATNENTWCPQKSIGPIVFGEPDCLKLNVYS
(33 a.a.)

- SilkBase 1999-2023 -