SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG12798_5prime_partial:A_BomaMSG_c22722_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		replication_protein_A1_[Bombyx_mori]
Ontology
GO:0000723 P telomere maintenance
GO:0000724 P double-strand break repair via homologous recombination
GO:0000784 C chromosome, telomeric region
GO:0000793 C condensed chromosome
GO:0000794 C condensed nuclear chromosome
GO:0000800 C lateral element
GO:0001673 C male germ cell nucleus
GO:0001701 P in utero embryonic development
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003697 F single-stranded DNA binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005662 C DNA replication factor A complex
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006284 P base-excision repair
GO:0006289 P nucleotide-excision repair
GO:0006298 P mismatch repair
GO:0006310 P DNA recombination
GO:0006974 P cellular response to DNA damage stimulus
GO:0007126 P meiotic cell cycle
GO:0008284 P positive regulation of cell population proliferation
GO:0016605 C PML body
GO:0030097 P hemopoiesis
GO:0046872 F metal ion binding
GO:0048873 P homeostasis of number of cells within a tissue
GO:0051276 P chromosome organization
RNA-seq EntryA_BomaMSG_c22722_g1_i1
Sequence
(Amino Acid)
NGGADADIVNISAKSGNFTGGSNEWISFSEAESRQLGTGEKGDYYSLLGVLTFTFSENAV
YKACPQEQCNKKLVDQENGLFRCEKCNREYPNYKHRILLAANVSDPTGDQRVTLFNEAAE
TMLGKSAEEIARLSEYDKNEYNRIFDEVKFKTFVFKFRTKMENFNDESRLKTTVVNVQPV
DYKDGIARLLKNIKTATGVQV
*(66 a.a.)

- SilkBase 1999-2023 -