SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG12106_5prime_partial:A_BomaMSG_c22403_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		probable_multidrug_resistance-associated_protein_lethal(2)03659_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0005215 F transporter activity
GO:0005324 F long-chain fatty acid transporter activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006810 P transport
GO:0006855 P xenobiotic transmembrane transport
GO:0006979 P response to oxidative stress
GO:0008559 F ABC-type xenobiotic transporter activity
GO:0015238 F xenobiotic transmembrane transporter activity
GO:0015431 F ABC-type glutathione S-conjugate transporter activity
GO:0015562 F efflux transmembrane transporter activity
GO:0015911 P long-chain fatty acid import across plasma membrane
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016323 C basolateral plasma membrane
GO:0016491 F oxidoreductase activity
GO:0016787 F hydrolase activity
GO:0016887 F ATP hydrolysis activity
GO:0030335 P positive regulation of cell migration
GO:0033700 P phospholipid efflux
GO:0034040 F ATPase-coupled lipid transmembrane transporter activity
GO:0034634 F glutathione transmembrane transporter activity
GO:0034775 P glutathione transmembrane transport
GO:0042493 P response to xenobiotic stimulus
GO:0042626 F ATPase-coupled transmembrane transporter activity
GO:0042908 P xenobiotic transport
GO:0043215 P daunorubicin transport
GO:0046618 P xenobiotic export
GO:0046624 F sphingolipid transporter activity
GO:0055085 P transmembrane transport
GO:0055114 P obsolete oxidation-reduction process
GO:0060326 P cell chemotaxis
GO:1901215 P negative regulation of neuron death
RNA-seq EntryA_BomaMSG_c22403_g2_i1
Sequence
(Amino Acid)
RSEERQLGDGGGSLSSGQRQLLCLARAALAGSSVLLLDEATANVDTETDKQIQRTIRTKF
SNATVLTIAHRLNTVMDYDRVIVMDKGRIVESGHPHELLTQSGPEQARRTLLSKNQAPLA
VPEECEGAVHRSRTYSEKSADSELEATGVFKTLVEQTGKETAAMLRRAAAESYKTWLEKK
KST
*(60 a.a.)

- SilkBase 1999-2023 -