SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG12054_3prime_partial:A_BomaMSG_c22365_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		NAD-dependent_protein_deacylase_Sirt4_[Bombyx_mori]
Ontology
GO:0000820 P regulation of glutamine family amino acid metabolic process
GO:0003950 F NAD+ ADP-ribosyltransferase activity
GO:0005515 F protein binding
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005759 C mitochondrial matrix
GO:0006471 P protein ADP-ribosylation
GO:0006541 P glutamine metabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0010667 P negative regulation of cardiac muscle cell apoptotic process
GO:0016740 F transferase activity
GO:0016787 F hydrolase activity
GO:0034979 F NAD-dependent protein deacetylase activity
GO:0034983 P peptidyl-lysine deacetylation
GO:0046322 P negative regulation of fatty acid oxidation
GO:0046676 P negative regulation of insulin secretion
GO:0046872 F metal ion binding
GO:0046889 P positive regulation of lipid biosynthetic process
GO:0047708 F biotinidase activity
GO:0061690 F lipoamidase activity
GO:0070403 F NAD+ binding
GO:0071456 P cellular response to hypoxia
GO:0072350 P tricarboxylic acid metabolic process
GO:1903217 P negative regulation of protein processing involved in protein targeting to mitochondrion
GO:1904182 P regulation of pyruvate dehydrogenase activity
RNA-seq EntryA_BomaMSG_c22365_g1_i1
Sequence
(Amino Acid)
MESSFSMIRPDGDVELSREQVEKFRAPLCPKCEGPLKPDIVFFGDNVPKYRVEQVRKEVT
SSDAIFVMGSSLTVYSSYRIILQARDEHKNVAILNIGPTR
(32 a.a.)

- SilkBase 1999-2023 -