SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG11813_internal:A_BomaMSG_c22216_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		protein_transport_protein_Sec31A_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0002474 P antigen processing and presentation of peptide antigen via MHC class I
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0030120 C vesicle coat
GO:0030127 C COPII vesicle coat
GO:0030134 C COPII-coated ER to Golgi transport vesicle
GO:0031410 C cytoplasmic vesicle
GO:0036498 P IRE1-mediated unfolded protein response
GO:0043231 C intracellular membrane-bounded organelle
GO:0048208 P COPII vesicle coating
GO:0048306 F calcium-dependent protein binding
GO:0048471 C perinuclear region of cytoplasm
GO:0051592 P response to calcium ion
GO:0070971 C endoplasmic reticulum exit site
RNA-seq EntryA_BomaMSG_c22216_g1_i1
Sequence
(Amino Acid)
PISYTPTHPAVNGSYYNPPGVETGVPVVATQNKPAAPGWNDPPMLSSKPKAKSETPVPAQ
APITHPLFGVEPPQHIPLAPAPGQYPGIQPGQYQGTQFPAAQPPVGQYSIVQQPIGQYPG
GQQHIGQYPGAQQPDGQYPGAQQLGGQYPGAQYPGGQYQDQQYQAQYPPQPPPQQYTPQV
EPQAAPKPPLPPPLAALQDTFDGLREQLARASTSSLVKRKLEDVQRRLETM
(76 a.a.)

- SilkBase 1999-2023 -