SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG1171_internal:A_BomaMSG_c4878_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		PREDICTED:_uncharacterized_protein_LOC106117298_[Papilio_xuthus]
Ontology
GO:0000159 C protein phosphatase type 2A complex
GO:0001754 P eye photoreceptor cell differentiation
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0006470 P protein dephosphorylation
GO:0007525 P somatic muscle development
GO:0008601 F protein phosphatase regulator activity
GO:0030674 F protein-macromolecule adaptor activity
GO:0034047 P regulation of phosphoprotein phosphatase activity
GO:0045732 P positive regulation of protein catabolic process
GO:0046872 F metal ion binding
GO:0061053 P somite development
GO:0090090 P negative regulation of canonical Wnt signaling pathway
GO:0090244 P Wnt signaling pathway involved in somitogenesis
GO:0090249 P regulation of cell migration involved in somitogenic axis elongation
GO:0090263 P positive regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomaMSG_c4878_g1_i1
Sequence
(Amino Acid)
QYFSYEHFYVIYCKFWELDRDHDLFIDRHDLARHNDHALSSRMIERVLSGCVTRGNQNRL
TPDGEPRMSYTEFVWFLLAEEDKTHPTAIEYWFRCMDIDGDGYISMYELEYFYEEQMQRM
EAIGIETLPFNDCLCQMLDMVHPAETGKITL
(49 a.a.)

- SilkBase 1999-2023 -