| Name | O_BomaMSG1168_3prime_partial:A_BomaMSG_c4873_g1_i1 |
| Scaffold_id | |
NCBI non-redundant
(nr) | trafficking_protein_particle_complex_subunit_4_[Bombyx_mori] |
| Ontology |
| GO:0005515 |
F |
protein binding |
| GO:0005783 |
C |
endoplasmic reticulum |
| GO:0005794 |
C |
Golgi apparatus |
| GO:0005795 |
C |
Golgi stack |
| GO:0005801 |
C |
cis-Golgi network |
| GO:0005886 |
C |
plasma membrane |
| GO:0006810 |
P |
transport |
| GO:0006888 |
P |
endoplasmic reticulum to Golgi vesicle-mediated transport |
| GO:0008021 |
C |
synaptic vesicle |
| GO:0016020 |
C |
membrane |
| GO:0016192 |
P |
vesicle-mediated transport |
| GO:0016358 |
P |
dendrite development |
| GO:0017112 |
F |
guanyl-nucleotide exchange factor activity |
| GO:0030008 |
C |
TRAPP complex |
| GO:0030054 |
C |
cell junction |
| GO:0030425 |
C |
dendrite |
| GO:0043547 |
P |
positive regulation of GTPase activity |
| GO:0045202 |
C |
synapse |
| GO:0045211 |
C |
postsynaptic membrane |
| GO:0045212 |
P |
obsolete neurotransmitter receptor biosynthetic process |
|
| RNA-seq Entry | A_BomaMSG_c4873_g1_i1 |
Sequence
(Amino Acid) | MVIYGIYIVSKSGGLIYNYDHNIPRVETEKTFGFPLDIKLQYENKKVVVAFGQRDGINVG
HVLLSVNGSPVTGRTTEDNRDVFDIIEAKENYPLSLKFGRVRATT
(34 a.a.) |
