SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG11681_internal:A_BomaMSG_c22156_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
kettin_protein_[Bombyx_mori]
Ontology
GO:0000794 C condensed nuclear chromosome
GO:0003779 F actin binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005863 C striated muscle myosin thick filament
GO:0005875 C microtubule associated complex
GO:0007049 P cell cycle
GO:0007062 P sister chromatid cohesion
GO:0007067 P mitotic cell cycle
GO:0007076 P mitotic chromosome condensation
GO:0007498 P mesoderm development
GO:0007517 P muscle organ development
GO:0007519 P skeletal muscle tissue development
GO:0007520 P myoblast fusion
GO:0007522 P visceral muscle development
GO:0007525 P somatic muscle development
GO:0008307 F structural constituent of muscle
GO:0016203 P muscle attachment
GO:0019233 P sensory perception of pain
GO:0030017 C sarcomere
GO:0030018 C Z disc
GO:0031674 C I band
GO:0035206 P regulation of hemocyte proliferation
GO:0040011 P locomotion
GO:0045214 P sarcomere organization
GO:0051301 P cell division
RNA-seq EntryA_BomaMSG_c22156_g1_i2
Sequence
(Amino Acid)
CSSDLVAGSTATRARLYVEVPKEPPPEQKRLHLPRPTKVIEPEPAPGPEIIYLRHVERAR
PYIPPGEEDRVYPPPQFIVPLKSVTAMEGGKIHFETRIEPVGDP
(33 a.a.)

- SilkBase 1999-2023 -