SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG1155_internal:A_BomaMSG_c4840_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
DNA_polymerase_delta_catalytic_subunit_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003887 F DNA-directed DNA polymerase activity
GO:0004518 F nuclease activity
GO:0004527 F exonuclease activity
GO:0005634 C nucleus
GO:0005875 C microtubule associated complex
GO:0006260 P DNA replication
GO:0006272 P leading strand elongation
GO:0006273 P lagging strand elongation
GO:0006287 P base-excision repair, gap-filling
GO:0006297 P nucleotide-excision repair, DNA gap filling
GO:0006974 P cellular response to DNA damage stimulus
GO:0008296 F 3'-5'-exodeoxyribonuclease activity
GO:0008310 F single-stranded DNA 3'-5' exodeoxyribonuclease activity
GO:0008408 F 3'-5' exonuclease activity
GO:0016740 F transferase activity
GO:0016779 F nucleotidyltransferase activity
GO:0016787 F hydrolase activity
GO:0019233 P sensory perception of pain
GO:0022008 P neurogenesis
GO:0043625 C delta DNA polymerase complex
GO:0045004 P DNA replication proofreading
GO:0046872 F metal ion binding
GO:0051536 F iron-sulfur cluster binding
GO:0051539 F 4 iron, 4 sulfur cluster binding
GO:0071897 P DNA biosynthetic process
GO:0090305 P nucleic acid phosphodiester bond hydrolysis
RNA-seq EntryA_BomaMSG_c4840_g1_i1
Sequence
(Amino Acid)
NVFTLNTCAPIVGSQVLSFQSESEMLSKWSDFFRELDPDIITGYNISNFDWPYLINRAKH
LNVQKFDFLGRIKKVRSVIKDTVLQSKQMGRRENKTINFEGRVPFDLLLVLVRDYKLRSY
TLNAVSYHFLQEQKEDVHHSIITDLQNESEQTRRRLAMYCLKDAYLP
(54 a.a.)

- SilkBase 1999-2023 -