SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG11541_internal:A_BomaMSG_c22070_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_spectrin_beta_chain,_non-erythrocytic_2_[Bombyx_mori]
Ontology
GO:0000165 P MAPK cascade
GO:0003779 F actin binding
GO:0005088 F guanyl-nucleotide exchange factor activity
GO:0005200 F structural constituent of cytoskeleton
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005516 F calmodulin binding
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0007411 P axon guidance
GO:0008091 C spectrin
GO:0015630 C microtubule cytoskeleton
GO:0016020 C membrane
GO:0019905 F syntaxin binding
GO:0031532 P actin cytoskeleton reorganization
GO:0032403 F protein-containing complex binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043547 P positive regulation of GTPase activity
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0051693 P actin filament capping
GO:0070062 C extracellular exosome
GO:1903561 C extracellular vesicle
RNA-seq EntryA_BomaMSG_c22070_g2_i1
Sequence
(Amino Acid)
RISKKAAIFSSTERGRELEAAHLLRRSHLARAAEASAVLTRIQELQADGTDLATRHPEHA
KDIEESLRNLREGWDNLQKLAERRTALLDAAINEHKFDENLKELEVWVSEAVKQMDEVED
PETMAEAQALLELHDEKKAEIDNRQKAIASLKKEAEQTPEKLKKVEHLSTTLDQAWLKRK
ENLTQAHQLQLLKEQARQIEDWLST
(67 a.a.)

- SilkBase 1999-2023 -