SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG1151_internal:A_BomaMSG_c4827_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
serine/threonine_kinase_LKB1_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0001558 P regulation of cell growth
GO:0001944 P vasculature development
GO:0002039 F p53 binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0009267 P cellular response to starvation
GO:0010212 P response to ionizing radiation
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0019901 F protein kinase binding
GO:0030010 P establishment of cell polarity
GO:0030295 F protein kinase activator activity
GO:0030308 P negative regulation of cell growth
GO:0032147 P activation of protein kinase activity
GO:0042493 P response to xenobiotic stimulus
GO:0042593 P glucose homeostasis
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
GO:0072332 P intrinsic apoptotic signaling pathway by p53 class mediator
RNA-seq EntryA_BomaMSG_c4827_g1_i1
Sequence
(Amino Acid)
DNVEYEISNVIAAQESDDNFMLDGSPELHSVTWLDDEQIEDLDLNLEQTNLCFHRVDSAD
IIYRSRKKKCKMVGKYVMGDVLGEGSYGKVKEMLDSQSLCRRAVKILKKRKLRRIPNGEQ
N
(39 a.a.)

- SilkBase 1999-2023 -