SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG11433_5prime_partial:A_BomaMSG_c22004_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		polycomb_[Bombyx_mori]
Ontology
GO:0000785 C chromatin
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003682 F chromatin binding
GO:0005634 C nucleus
GO:0005725 C intercalary heterochromatin
GO:0005730 C nucleolus
GO:0006342 P heterochromatin assembly
GO:0006355 P regulation of transcription, DNA-templated
GO:0007385 P specification of segmental identity, abdomen
GO:0007419 P ventral cord development
GO:0016322 P neuron remodeling
GO:0016458 P obsolete gene silencing
GO:0022008 P neurogenesis
GO:0035064 F methylated histone binding
GO:0035102 C PRC1 complex
GO:0035186 P syncytial blastoderm mitotic cell cycle
GO:0042060 P wound healing
GO:0045892 P negative regulation of transcription, DNA-templated
GO:2001229 P negative regulation of response to gamma radiation
RNA-seq EntryA_BomaMSG_c22004_g1_i1
Sequence
(Amino Acid)
SPERERRTETQPTATVPAEPKGARPAPQAPQPEDEDSWGEAPVAVPVPASAPAAKRGAAY
WMARSPVADQIFITDVTVNLQTVTITECRTEKGFFRSREPRPLDAT
*(34 a.a.)

- SilkBase 1999-2023 -