SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG11371_3prime_partial:A_BomaMSG_c21965_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
myocyte_enhancing_factor_2_isoform_A_[Bombyx_mori]
Ontology
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001158 F cis-regulatory region sequence-specific DNA binding
GO:0001205 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007275 P multicellular organism development
GO:0007496 P anterior midgut development
GO:0007498 P mesoderm development
GO:0007507 P heart development
GO:0007517 P muscle organ development
GO:0007519 P skeletal muscle tissue development
GO:0007520 P myoblast fusion
GO:0010468 P regulation of gene expression
GO:0016202 P regulation of striated muscle tissue development
GO:0019730 P antimicrobial humoral response
GO:0019915 P lipid storage
GO:0030154 P cell differentiation
GO:0030707 P ovarian follicle cell development
GO:0032968 P positive regulation of transcription elongation from RNA polymerase II promoter
GO:0045475 P locomotor rhythm
GO:0046983 F protein dimerization activity
GO:0048747 P muscle cell development
GO:0052576 P carbohydrate storage
RNA-seq EntryA_BomaMSG_c21965_g1_i1
Sequence
(Amino Acid)
MGRKKIQISRITDERNRQVTFNKRKFGVMKKAYELSVLCDCEIALIIFSSNNKLYQYAST
DMDKVLLKYTEYNEPHESLTNRNIIEALTKKEHKNGVMSPDSPEAEPEYNLTPRTEAKYS
KIDEEFQMMMQRNQLNGSRVGVGVTGSNYNLPVSVPVGNYDQSLLQASPQMHTSISPRPS
SSETDSVYPSGGMLEMSNGYPGSASPLGAGCTPSPSPGPAPSPRSE
(74 a.a.)

- SilkBase 1999-2023 -