SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG11254_complete:A_BomaMSG_c21917_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		LOW_QUALITY_PROTEIN:_transcription_factor_SOX-14_[Bombyx_mori]
Ontology
GO:0001649 P osteoblast differentiation
GO:0001654 P eye development
GO:0001714 P endodermal cell fate specification
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005623 C obsolete cell
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007050 P regulation of cell cycle
GO:0007275 P multicellular organism development
GO:0009611 P response to wounding
GO:0010468 P regulation of gene expression
GO:0016360 P sensory organ precursor cell fate determination
GO:0021983 P pituitary gland development
GO:0030900 P forebrain development
GO:0035019 P somatic stem cell population maintenance
GO:0035198 F miRNA binding
GO:0043281 P regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043410 P positive regulation of MAPK cascade
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045665 P negative regulation of neuron differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0048839 P inner ear development
GO:0050680 P negative regulation of epithelial cell proliferation
GO:0070848 P response to growth factor
GO:0090090 P negative regulation of canonical Wnt signaling pathway
RNA-seq EntryA_BomaMSG_c21917_g1_i2
Sequence
(Amino Acid)
MLTMETDLKGGSLHATVPPHHALQHGYGSLGALGGMMALPQQQPLGQHQPLQHQHHQQLT
QHHAPPQQQHHQTPNNNNNNTSKNSNAERVKRPMNAFMVWSRGQRRKMASDNPKMHNSEI
SKRLGAQWKDLSESEKRPFIDEAKRLRAVHMKEHPDYKYRPRRKTKTLAKKQEKYPLGGG
GLLGATEAQRSAAPTAQQPRDVYQMTPNGYMPNGYMMHDPSAYQQQAYGYPRYDVSQMQQ
GGYGGGYYGGGGQGSPYLPQPPSPSAYALGPGSPGGYALPPSCASHSPSGSSAKSEPVSP
GPPGMKREFISHEPPAQLKREFPPHPQSHEQMTMKREYGQQDLSHIINMYHVPDEQRYAA
VGERTMPLI
*(122 a.a.)

- SilkBase 1999-2023 -