SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG11194_3prime_partial:A_BomaMSG_c21888_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		Nibrin_[Operophtera_brumata]
Ontology
GO:0000723 P telomere maintenance
GO:0000724 P double-strand break repair via homologous recombination
GO:0000781 C chromosome, telomeric region
GO:0000784 C chromosome, telomeric region
GO:0003684 F damaged DNA binding
GO:0004003 F DNA helicase activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0006281 P DNA repair
GO:0006302 P double-strand break repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0008134 F transcription factor binding
GO:0016233 P telomere capping
GO:0030870 C Mre11 complex
GO:0032508 P DNA duplex unwinding
GO:0042405 C nuclear inclusion body
GO:0042770 P signal transduction in response to DNA damage
GO:0047485 F protein N-terminus binding
GO:0048145 P regulation of fibroblast proliferation
GO:0051321 P meiotic cell cycle
RNA-seq EntryA_BomaMSG_c21888_g1_i1
Sequence
(Amino Acid)
MPALTLTIKVVFALVQGSYIVTTEFWNKCLESIHSLSIPPDPQLFTPEIIETTLNREIVS
FLPNDKRKGLFLGIKCVFFSKRQFEVYKKVLVKSSAEPLLLSESKLTKASLCEPDFIVIQ
YNISNTSQETQAQKNQMLEIISYLKSKGKRVIPEDRK
(51 a.a.)

- SilkBase 1999-2023 -