SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG11173_internal:A_BomaMSG_c21876_g2_i2
Scaffold_id
NCBI non-redundant
(nr)
rho-associated_protein_kinase_isoform_X1_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0003383 P apical constriction
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005814 C centriole
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0006915 P apoptotic process
GO:0006921 P cellular component disassembly involved in execution phase of apoptosis
GO:0006939 P smooth muscle contraction
GO:0007159 P leukocyte cell-cell adhesion
GO:0007165 P signal transduction
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0007266 P Rho protein signal transduction
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016525 P negative regulation of angiogenesis
GO:0016740 F transferase activity
GO:0017048 F small GTPase binding
GO:0017049 F small GTPase binding
GO:0022614 P membrane to membrane docking
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0030155 P regulation of cell adhesion
GO:0030866 P cortical actin cytoskeleton organization
GO:0032059 C bleb
GO:0032060 P bleb assembly
GO:0032091 P negative regulation of protein binding
GO:0032956 P regulation of actin cytoskeleton organization
GO:0032970 P regulation of actin filament-based process
GO:0035509 P negative regulation of myosin-light-chain-phosphatase activity
GO:0035556 P intracellular signal transduction
GO:0042995 C cell projection
GO:0043524 P negative regulation of neuron apoptotic process
GO:0045616 P regulation of keratinocyte differentiation
GO:0046872 F metal ion binding
GO:0048010 P vascular endothelial growth factor receptor signaling pathway
GO:0048013 P ephrin receptor signaling pathway
GO:0050900 P leukocyte migration
GO:0050901 P leukocyte tethering or rolling
GO:0051451 P myoblast migration
GO:0051492 P regulation of stress fiber assembly
GO:0051493 P regulation of cytoskeleton organization
GO:0051893 P regulation of focal adhesion assembly
GO:0051894 P positive regulation of focal adhesion assembly
GO:0090002 P protein localization to plasma membrane
GO:1903140 P regulation of establishment of endothelial barrier
GO:1903347 P negative regulation of bicellular tight junction assembly
GO:2000114 P regulation of establishment of cell polarity
GO:2000145 P regulation of cell motility
RNA-seq EntryA_BomaMSG_c21876_g2_i2
Sequence
(Amino Acid)
NSVDEIKQHPFFINDQWSFENLRDSVPPVVPELSSDDDTRNFDDIEKSDALDESFPVPKA
FVGNHLPFVGFTYNGDYQLCTRQKKANDVVDTISNNHINNDGSEAIYQLEKLLERERDGK
RKLEDTQAALCAQLEELSQRELRNKKIISESDKEVALLRHDLKEIQRIAELEVESRRKAE
ANLNEAKRRLEEEQTKRTKEMSNLHIYNEKINALEKQLEELREK
(73 a.a.)

- SilkBase 1999-2023 -