SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG11154_complete:A_BomaMSG_c21864_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		JAB-MPN_domain_protein_[Bombyx_mori]
Ontology
GO:0000338 P protein deneddylation
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006508 P proteolysis
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007275 P multicellular organism development
GO:0007281 P germ cell development
GO:0007310 P oocyte dorsal/ventral axis specification
GO:0007314 P oocyte anterior/posterior axis specification
GO:0007409 P axonogenesis
GO:0008180 C COP9 signalosome
GO:0008233 F peptidase activity
GO:0008237 F metallopeptidase activity
GO:0008347 P glial cell migration
GO:0010388 P protein deneddylation
GO:0016787 F hydrolase activity
GO:0019781 F NEDD8 activating enzyme activity
GO:0019784 F NEDD8-specific protease activity
GO:0030154 P cell differentiation
GO:0032435 P negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034399 C nuclear periphery
GO:0035204 P negative regulation of lamellocyte differentiation
GO:0035207 P negative regulation of hemocyte proliferation
GO:0036099 P female germ-line stem cell population maintenance
GO:0045787 P positive regulation of cell cycle
GO:0046872 F metal ion binding
GO:0048140 P male germ-line cyst encapsulation
GO:0048142 P germarium-derived cystoblast division
GO:0048477 P oogenesis
GO:0050821 P protein stabilization
GO:2000600 P positive regulation of cellular protein catabolic process
RNA-seq EntryA_BomaMSG_c21864_g1_i1
Sequence
(Amino Acid)
MASTSADSQASIAQKTWVMANNIETVSNVDDIYRYDKKQQQDILAAKPWEKDPHFFKDIK
ISALALLKMVMHARSGGTLEVMGLLLGKVDANTMIVMDSFALPVEGTETRVNAQAQAYEY
MTAYIEAAKQVGRHENAIGWYHSHPGYGCWLSGIDVSTQMLNQNFQEPFVAIVIDPVRTI
SAGKVCLGAFRTYPKGYKPANEEPSEYQTIPLNKIEDFGVHCKQYYSLEVSYFKSSLDRR
LLDSLWNKYWVNTLSSSSLITNADYTTGQIFDLSDKLEQSEVCLGRGAFVVAGADPHEKR
TEDKLGKATKDACKTTIEVIHGLMAQMIKDRLFNSVCGRQAAPTPMIE
*(115 a.a.)

- SilkBase 1999-2023 -