SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG11073_3prime_partial:A_BomaMSG_c21818_g1_i2
Scaffold_id
NCBI non-redundant
(nr)		c-Jun_NH2-terminal_kinase_isoform_X2_[Bombyx_mori]
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0001736 P establishment of planar polarity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004705 F JUN kinase activity
GO:0004707 F MAP kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0006468 P protein phosphorylation
GO:0006952 P defense response
GO:0006979 P response to oxidative stress
GO:0007254 P JNK cascade
GO:0007258 P JUN phosphorylation
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007391 P dorsal closure
GO:0007411 P axon guidance
GO:0007616 P long-term memory
GO:0009267 P cellular response to starvation
GO:0009408 P response to heat
GO:0010508 P positive regulation of autophagy
GO:0016055 P Wnt signaling pathway
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016319 P mushroom body development
GO:0016740 F transferase activity
GO:0019731 P antibacterial humoral response
GO:0030424 C axon
GO:0030425 C dendrite
GO:0030707 P ovarian follicle cell development
GO:0034599 P cellular response to oxidative stress
GO:0034614 P cellular response to reactive oxygen species
GO:0035006 P melanization defense response
GO:0035313 P wound healing, spreading of epidermal cells
GO:0042060 P wound healing
GO:0043508 P negative regulation of JUN kinase activity
GO:0043652 P engulfment of apoptotic cell
GO:0046529 P imaginal disc fusion, thorax closure
GO:0046843 P dorsal appendage formation
GO:0046844 P chorion micropyle formation
GO:0048615 P embryonic anterior midgut (ectodermal) morphogenesis
GO:0048666 P neuron development
GO:0048674 P collateral sprouting of injured axon
GO:0048675 P axon extension
GO:0048803 P imaginal disc-derived male genitalia morphogenesis
GO:0048812 P neuron projection morphogenesis
GO:0071243 P cellular response to arsenic-containing substance
GO:0071276 P cellular response to cadmium ion
GO:0071907 P determination of digestive tract left/right asymmetry
GO:1903688 P positive regulation of border follicle cell migration
GO:1904801 P positive regulation of neuron remodeling
RNA-seq EntryA_BomaMSG_c21818_g1_i2
Sequence
(Amino Acid)
MLIEYNSGKMIQYYSVTVGDAVFTIPTRYTELVVRGAGAQGMVCAAYDTVTQQNVAIKKL
SRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQKSLEEFQDVYLVMELMDANLCQ
VIQMDLDHERMSYLLYQMLCGIKHLHLAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAG
TTFMMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKI
IEQLGTPSAAFMSRLQPTVRNYVENRPRYSGYSFERLFPDILFPSDSNEHNRLKASQARD
LLSRMLVIDPERRISVDDALLHPYINVWYDEVEVNAPAPASYDHSVDEREHTVEQWKQLI
YQEVVEYSAPPHPPPP
(124 a.a.)

- SilkBase 1999-2023 -