SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG11016_complete:A_BomaMSG_c21792_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
apoptosis-linked_protein_2_isoform_X2_[Bombyx_mori]
Ontology
GO:0001525 P angiogenesis
GO:0001938 P positive regulation of endothelial cell proliferation
GO:0004198 F calcium-dependent cysteine-type endopeptidase activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006886 P intracellular protein transport
GO:0006915 P apoptotic process
GO:0006919 P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010595 P positive regulation of endothelial cell migration
GO:0016020 C membrane
GO:0030948 P negative regulation of vascular endothelial growth factor receptor signaling pathway
GO:0031410 C cytoplasmic vesicle
GO:0031965 C nuclear membrane
GO:0032007 P negative regulation of TOR signaling
GO:0034605 P cellular response to heat
GO:0036324 P vascular endothelial growth factor receptor-2 signaling pathway
GO:0042802 F identical protein binding
GO:0042803 F protein homodimerization activity
GO:0043280 P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043495 F protein-membrane adaptor activity
GO:0045766 P positive regulation of angiogenesis
GO:0046872 F metal ion binding
GO:0046983 F protein dimerization activity
GO:0048306 F calcium-dependent protein binding
GO:0051592 P response to calcium ion
GO:0051898 P negative regulation of protein kinase B signaling
GO:0060090 F molecular adaptor activity
GO:0070062 C extracellular exosome
GO:0070971 C endoplasmic reticulum exit site
RNA-seq EntryA_BomaMSG_c21792_g1_i1
Sequence
(Amino Acid)
MTFQSPMPSRDFLWNIFRSVDKDRSGYISADELQQALSNGTWNPFNPETVRLMIGMFDKQ
NRGVISFEDFGALWKYVSDWQNCFRSFDRDNSGNIDRVELKNALTAFGYRLSDDVVGIMV
QKFDRFGRGTILFDDFIQCCVTLYTLTSAFRQYDSDQDGVITIHYEQFLKMVFGLKV
*(58 a.a.)

- SilkBase 1999-2023 -