SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10997_3prime_partial:A_BomaMSG_c21782_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_Mdm2-like_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001568 P blood vessel development
GO:0001974 P blood vessel remodeling
GO:0002027 P regulation of heart rate
GO:0002039 F p53 binding
GO:0003170 P heart valve development
GO:0003181 P atrioventricular valve morphogenesis
GO:0003203 P endocardial cushion morphogenesis
GO:0003281 P ventricular septum development
GO:0003283 P atrial septum development
GO:0004842 F ubiquitin-protein transferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006461 P protein-containing complex assembly
GO:0006977 P DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0007089 P traversing start control point of mitotic cell cycle
GO:0007507 P heart development
GO:0008270 F zinc ion binding
GO:0009636 P response to toxic substance
GO:0009743 P response to carbohydrate
GO:0010039 P response to iron ion
GO:0010468 P regulation of gene expression
GO:0010628 P positive regulation of gene expression
GO:0010629 P negative regulation of gene expression
GO:0010955 P negative regulation of protein processing
GO:0016567 P protein ubiquitination
GO:0016604 C nuclear body
GO:0016874 F ligase activity
GO:0018205 P peptidyl-lysine modification
GO:0019899 F enzyme binding
GO:0031625 F ubiquitin protein ligase binding
GO:0031648 P protein destabilization
GO:0032026 P response to magnesium ion
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0034504 P protein localization to nucleus
GO:0042176 P regulation of protein catabolic process
GO:0042220 P response to cocaine
GO:0042493 P response to xenobiotic stimulus
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0042802 F identical protein binding
GO:0042975 F peroxisome proliferator activated receptor binding
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043234 C protein-containing complex
GO:0043278 P response to morphine
GO:0043518 P negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0045184 P establishment of protein localization
GO:0045202 C synapse
GO:0045472 P response to ether
GO:0045787 P positive regulation of cell cycle
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045931 P positive regulation of mitotic cell cycle
GO:0046677 P response to antibiotic
GO:0046827 P positive regulation of protein export from nucleus
GO:0046872 F metal ion binding
GO:0048545 P response to steroid hormone
GO:0060411 P cardiac septum morphogenesis
GO:0061630 F ubiquitin protein ligase activity
GO:0070301 P cellular response to hydrogen peroxide
GO:0071157 P regulation of cell cycle
GO:0071236 P cellular response to antibiotic
GO:0071301 P cellular response to vitamin B1
GO:0071310 P cellular response to organic substance
GO:0071312 P cellular response to alkaloid
GO:0071363 P cellular response to growth factor stimulus
GO:0071375 P cellular response to peptide hormone stimulus
GO:0071391 P cellular response to estrogen stimulus
GO:0071407 P cellular response to organic cyclic compound
GO:0071456 P cellular response to hypoxia
GO:0071494 P cellular response to UV-C
GO:0097110 F scaffold protein binding
GO:1901797 P negative regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomaMSG_c21782_g1_i1
Sequence
(Amino Acid)
MTWFDSEIWHLLFVPDCNMNTTFCSETSVSRRCSTETIYSIQGKETDFARDTSDTDASIF
DTDAEIEFEPASDDEEDQAPVDEDTSASFTDGEIIKTKVLEVSVGDDGDLQLADSEQTDS
QDSDSEIDLYDFWHCIKCRAENNVPFYRYCQKCFQVRKNFFPPRPKRKRKRGTTVTPELD
AVPRTLSQDSGIQSVHSQELFNKNCLTARTRPTVRALRETLTVALSSQVERGRDAPG
(78 a.a.)

- SilkBase 1999-2023 -