SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10985_5prime_partial:A_BomaMSG_c21775_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		breast_cancer_type_1_susceptibility_protein_homolog_[Bombyx_mori]
Ontology
GO:0000724 P double-strand break repair via homologous recombination
GO:0000793 C condensed chromosome
GO:0000794 C condensed nuclear chromosome
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003684 F damaged DNA binding
GO:0003723 F RNA binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005759 C mitochondrial matrix
GO:0005813 C centrosome
GO:0005886 C plasma membrane
GO:0006260 P DNA replication
GO:0006281 P DNA repair
GO:0006301 P postreplication repair
GO:0006302 P double-strand break repair
GO:0006310 P DNA recombination
GO:0006349 P regulation of gene expression by genomic imprinting
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006629 P lipid metabolic process
GO:0006631 P fatty acid metabolic process
GO:0006633 P fatty acid biosynthetic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007098 P centrosome cycle
GO:0007420 P brain development
GO:0007584 P response to nutrient
GO:0008270 F zinc ion binding
GO:0008630 P intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009048 P dosage compensation by inactivation of X chromosome
GO:0010033 P response to organic substance
GO:0010212 P response to ionizing radiation
GO:0010575 P positive regulation of vascular endothelial growth factor production
GO:0010628 P positive regulation of gene expression
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019899 F enzyme binding
GO:0030529 C ribonucleoprotein complex
GO:0031052 P chromosome breakage
GO:0031398 P positive regulation of protein ubiquitination
GO:0031436 C BRCA1-BARD1 complex
GO:0031572 P mitotic G2 DNA damage checkpoint signaling
GO:0031625 F ubiquitin protein ligase binding
GO:0032355 P response to estradiol
GO:0033147 P negative regulation of intracellular estrogen receptor signaling pathway
GO:0033160 P obsolete positive regulation of protein import into nucleus, translocation
GO:0033993 P response to lipid
GO:0035066 P positive regulation of histone acetylation
GO:0035067 P negative regulation of histone acetylation
GO:0042127 P regulation of cell population proliferation
GO:0043009 P chordate embryonic development
GO:0043234 C protein-containing complex
GO:0043627 P response to estrogen
GO:0044030 P regulation of DNA methylation
GO:0044212 F transcription cis-regulatory region binding
GO:0045717 P negative regulation of fatty acid biosynthetic process
GO:0045739 P positive regulation of DNA repair
GO:0045766 P positive regulation of angiogenesis
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051298 P centrosome duplication
GO:0051571 P positive regulation of histone H3-K4 methylation
GO:0051572 P negative regulation of histone H3-K4 methylation
GO:0051573 P negative regulation of histone H3-K9 methylation
GO:0051574 P positive regulation of histone H3-K9 methylation
GO:0051865 P protein autoubiquitination
GO:0070512 P positive regulation of histone H4-K20 methylation
GO:0070531 C BRCA1-A complex
GO:0071158 P regulation of cell cycle
GO:0071356 P cellular response to tumor necrosis factor
GO:0071681 P cellular response to indole-3-methanol
GO:0085020 P protein K6-linked ubiquitination
GO:1902042 P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2000378 P negative regulation of reactive oxygen species metabolic process
GO:2000617 P positive regulation of histone H3-K9 acetylation
GO:2000620 P positive regulation of histone H4-K16 acetylation
RNA-seq EntryA_BomaMSG_c21775_g1_i1
Sequence
(Amino Acid)
VLFRSVEKCLHLKKYVDEAPYEALDSTGEPGPKRSRISKRKLFHGITFYCMPSFTVLDLQ
TLKSMLEAAGGRVVTDPKYVRISKDAPGPALLLAEPENTQEDRFIYLAMEQSIVPVNYEW
ALNCLGSYTLGSVQELLLCPAALLPTLTSQWPACLIAREYDD
*(53 a.a.)

- SilkBase 1999-2023 -