SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10939_3prime_partial:A_BomaMSG_c21747_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		protein_muscleblind_isoform_X5_[Bombyx_mori]
Ontology
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0001654 P eye development
GO:0001751 P compound eye photoreceptor cell differentiation
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006915 P apoptotic process
GO:0007275 P multicellular organism development
GO:0007422 P peripheral nervous system development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007517 P muscle organ development
GO:0007525 P somatic muscle development
GO:0007601 P visual perception
GO:0009790 P embryo development
GO:0010468 P regulation of gene expression
GO:0030018 C Z disc
GO:0031673 C H zone
GO:0042052 P rhabdomere development
GO:0045924 P regulation of female receptivity
GO:0046716 P muscle cell cellular homeostasis
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0050896 P response to stimulus
RNA-seq EntryA_BomaMSG_c21747_g2_i1
Sequence
(Amino Acid)
MATMVNMNSLLNGKDSRWLQLEVCREFQRNKCSRPDTECKFAHPPATVEVQNGRVTACYD
SIKGRCNREKPPCKYFHPPQHLKDQLLINGRNHLALKNALMQQMGLTPGQVLPGQVPAV
(38 a.a.)

- SilkBase 1999-2023 -