SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG10920_complete:A_BomaMSG_c21731_g1_i2
Scaffold_id
NCBI non-redundant
(nr)
TRAF6_isoform_X1_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000209 P protein polyubiquitination
GO:0001503 P ossification
GO:0001843 P neural tube closure
GO:0002376 P immune system process
GO:0002726 P positive regulation of T cell cytokine production
GO:0004842 F ubiquitin-protein transferase activity
GO:0005164 F tumor necrosis factor receptor binding
GO:0005634 C nucleus
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0005938 C cell cortex
GO:0006955 P immune response
GO:0007165 P signal transduction
GO:0007249 P I-kappaB kinase/NF-kappaB signaling
GO:0007250 P activation of NF-kappaB-inducing kinase activity
GO:0008270 F zinc ion binding
GO:0009887 P animal organ morphogenesis
GO:0009898 C cytoplasmic side of plasma membrane
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0019886 P antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0019901 F protein kinase binding
GO:0030316 P osteoclast differentiation
GO:0031435 F mitogen-activated protein kinase kinase kinase binding
GO:0031624 F ubiquitin conjugating enzyme binding
GO:0031625 F ubiquitin protein ligase binding
GO:0031666 P positive regulation of lipopolysaccharide-mediated signaling pathway
GO:0031996 F thioesterase binding
GO:0032147 P activation of protein kinase activity
GO:0032743 P positive regulation of interleukin-2 production
GO:0035631 C CD40 receptor complex
GO:0042088 P T-helper 1 type immune response
GO:0042102 P positive regulation of T cell proliferation
GO:0042475 P odontogenesis of dentin-containing tooth
GO:0042802 F identical protein binding
GO:0042826 F histone deacetylase binding
GO:0042981 P regulation of apoptotic process
GO:0043011 P myeloid dendritic cell differentiation
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043234 C protein-containing complex
GO:0043422 F protein kinase B binding
GO:0043507 P positive regulation of JUN kinase activity
GO:0045084 P positive regulation of interleukin-12 production
GO:0045410 P positive regulation of interleukin-6 production
GO:0045453 P bone resorption
GO:0045672 P positive regulation of osteoclast differentiation
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046849 P bone remodeling
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0048468 P cell development
GO:0048471 C perinuclear region of cytoplasm
GO:0050852 P T cell receptor signaling pathway
GO:0051023 P regulation of immunoglobulin production
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051092 P positive regulation of NF-kappaB transcription factor activity
GO:0051865 P protein autoubiquitination
GO:0061630 F ubiquitin protein ligase activity
GO:0070498 P interleukin-1-mediated signaling pathway
GO:0070534 P protein K63-linked ubiquitination
GO:0070555 P response to interleukin-1
GO:0071222 P cellular response to lipopolysaccharide
GO:2000679 P positive regulation of transcription regulatory region DNA binding
RNA-seq EntryA_BomaMSG_c21731_g1_i2
Sequence
(Amino Acid)
MDRNRAKDASEGIAPMGITALNETVLSNQPESRYECPVCLNWLRDPVITTCGHKFCKSCI
TSWLQNSGHCPIDNINLSMKVDIFPDNYTKREIQEQRMNCPFSAKGCTVKVTPLDLDAHI
AVCEYNQPETSSQPEIHIPCSFKPAGCKETFDSQDEMNQHLNNDTQSHMNLLMNAYSEMK
INNDMSNANMDTKEQEAMALWDAPDKDGNQTSSPPLNNTSALIRALYERVVVLEQRNREQ
DIVIANISKQLSAFAVAKMKQNNEMLLRYCMGNYVWRIDNFKTRLDAMLKDHYKMLYSPG
FYTSPNGYRFCVRLNISPQNTHFFALHVHLMKTENDDCLEWPFNGRISFVLVNQVYPELS
QRDTMMSNTNLKAFSKPATEICVRGFGYTEYAVLGDVIRNGFVKDDVLIIRVNIKCV
*(138 a.a.)

- SilkBase 1999-2023 -