SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10796_5prime_partial:A_BomaMSG_c21664_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		epidermal_growth_factor_receptor_kinase_substrate_8_isoform_X3_[Bombyx_mori]
Ontology
GO:0003779 F actin binding
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0005903 C brush border
GO:0005938 C cell cortex
GO:0008344 P adult locomotory behavior
GO:0008360 P regulation of cell shape
GO:0009967 P positive regulation of signal transduction
GO:0010458 P exit from mitosis
GO:0014069 C postsynaptic density
GO:0016020 C membrane
GO:0016601 P Rac protein signal transduction
GO:0017146 C NMDA selective glutamate receptor complex
GO:0030054 C cell junction
GO:0030426 C growth cone
GO:0030832 P regulation of actin filament length
GO:0031532 P actin cytoskeleton reorganization
GO:0031982 C vesicle
GO:0032420 C stereocilium
GO:0032587 C ruffle membrane
GO:0035591 F signaling adaptor activity
GO:0036336 P dendritic cell migration
GO:0042995 C cell projection
GO:0043005 C neuron projection
GO:0045202 C synapse
GO:0048149 P behavioral response to ethanol
GO:0048365 F small GTPase binding
GO:0051016 P barbed-end actin filament capping
GO:0051017 P actin filament bundle assembly
GO:0051764 P actin crosslink formation
GO:0070062 C extracellular exosome
GO:0070358 P actin polymerization-dependent cell motility
RNA-seq EntryA_BomaMSG_c21664_g1_i1
Sequence
(Amino Acid)
CALPISQIQQRRSKLDIKKTPDIFIDQKSNPDEVVEWLEAKGFSNAAQRQLRMSGHQLFA
LSRSQLERALGQDEGKRLYSQILVQRNVSGYKTTSASELQSILRRVREKVEVS
*(37 a.a.)

- SilkBase 1999-2023 -