SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG1070_internal:A_BomaMSG_c4628_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		protein_ECT2_isoform_X4_[Bombyx_mori]
Ontology
GO:0000902 P cell morphogenesis
GO:0000910 P cytokinesis
GO:0004871 F obsolete signal transducer activity
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005089 F guanyl-nucleotide exchange factor activity
GO:0005096 F GTPase activator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0005911 C cell-cell junction
GO:0005923 C bicellular tight junction
GO:0006810 P transport
GO:0007049 P cell cycle
GO:0007399 P nervous system development
GO:0015031 P protein transport
GO:0017048 F small GTPase binding
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030496 C midbody
GO:0032147 P activation of protein kinase activity
GO:0032154 C cleavage furrow
GO:0032467 P positive regulation of cytokinesis
GO:0035023 P regulation of Rho protein signal transduction
GO:0035556 P intracellular signal transduction
GO:0042307 P positive regulation of protein import into nucleus
GO:0042803 F protein homodimerization activity
GO:0043065 P positive regulation of apoptotic process
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043547 P positive regulation of GTPase activity
GO:0045666 P positive regulation of neuron differentiation
GO:0045859 P regulation of protein kinase activity
GO:0051056 P regulation of small GTPase mediated signal transduction
GO:0051260 P protein homooligomerization
GO:0051301 P cell division
GO:0051988 P regulation of attachment of spindle microtubules to kinetochore
GO:0070301 P cellular response to hydrogen peroxide
GO:0070830 P bicellular tight junction assembly
GO:0071277 P cellular response to calcium ion
GO:0071479 P cellular response to ionizing radiation
GO:0072686 C mitotic spindle
GO:0090630 P activation of GTPase activity
GO:0097149 C centralspindlin complex
RNA-seq EntryA_BomaMSG_c4628_g1_i1
Sequence
(Amino Acid)
TNGTGTMRIGSSKPYRHISLMPLSTVKRVVDIREAEDCHNVSALMCRNNQELKEKLYSFM
ITDETVDKSHFLRQLCRQMANTVCKADADKFLACLESHQMDIDTSDLALSTLSKVSKFAA
RTRIKVGRALSFNKTPSKLKRAMSSMISPFGSTSNLTPASQLAQMRLASCNNINVSLVPG
GRSGSRTAEPE
(62 a.a.)

- SilkBase 1999-2023 -