SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG10690_internal:A_BomaMSG_c21597_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PIAS2_protein_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0003677 F DNA binding
GO:0003713 F transcription coactivator activity
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007259 P receptor signaling pathway via JAK-STAT
GO:0008134 F transcription factor binding
GO:0008270 F zinc ion binding
GO:0016605 C PML body
GO:0016607 C nuclear speck
GO:0016874 F ligase activity
GO:0016925 P protein sumoylation
GO:0019789 F SUMO transferase activity
GO:0019899 F enzyme binding
GO:0030521 P androgen receptor signaling pathway
GO:0031625 F ubiquitin protein ligase binding
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0033235 P positive regulation of protein sumoylation
GO:0042127 P regulation of cell population proliferation
GO:0045444 P fat cell differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046872 F metal ion binding
GO:0050681 F androgen receptor binding
GO:0060334 P regulation of interferon-gamma-mediated signaling pathway
GO:0061665 F SUMO ligase activity
RNA-seq EntryA_BomaMSG_c21597_g1_i1
Sequence
(Amino Acid)
ALPISDVKFKKLPFYDVLAELMKPSTMMPVQAGRMQESTYIFHLTPQQATEIATGKDIVG
TSNKLDYIIQAQLRFCLLETSCEQEDHFPPSVNVKVNNKMCPLPNPIPTNKPTPEPKRPP
(39 a.a.)

- SilkBase 1999-2023 -