SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10688_5prime_partial:A_BomaMSG_c21594_g2_i1
Scaffold_id
NCBI non-redundant
(nr)		headcase_protein_[Bombyx_mori]
Ontology
GO:0002165 P instar larval or pupal development
GO:0003674 F molecular_function
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0007275 P multicellular organism development
GO:0007424 P open tracheal system development
GO:0007430 P terminal branching, open tracheal system
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0016246 P RNA interference
GO:0022008 P neurogenesis
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0030425 C dendrite
GO:0035071 P salivary gland cell autophagic cell death
GO:0035147 P branch fusion, open tracheal system
GO:0035155 P negative regulation of terminal cell fate specification, open tracheal system
GO:0048471 C perinuclear region of cytoplasm
GO:0048675 P axon extension
GO:0050768 P negative regulation of neurogenesis
GO:1904799 P regulation of neuron remodeling
RNA-seq EntryA_BomaMSG_c21594_g2_i1
Sequence
(Amino Acid)
KVEGRTQYLTCVCMGCLERCDPDRTIRCRFCGQKWDGSSLVLGTMYSYDIFMATPCCAER
LKCNSCYKPLLHPQQRLNYSDYSHPVTCPQCRVTDTHFVKPLTYCFTKRVYPLFQQWP
*(38 a.a.)

- SilkBase 1999-2023 -