SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10642_5prime_partial:A_BomaMSG_c21560_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		E3_ubiquitin-protein_ligase_UBR5_[Bombyx_mori]
Ontology
GO:0000209 P protein polyubiquitination
GO:0003723 F RNA binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0007112 P male meiosis cytokinesis
GO:0007281 P germ cell development
GO:0007283 P spermatogenesis
GO:0007289 P spermatid nucleus differentiation
GO:0007444 P imaginal disc development
GO:0007446 P imaginal disc growth
GO:0007455 P eye-antennal disc morphogenesis
GO:0008270 F zinc ion binding
GO:0008585 P female gonad development
GO:0016874 F ligase activity
GO:0030162 P regulation of proteolysis
GO:0034450 F ubiquitin-ubiquitin ligase activity
GO:0042127 P regulation of cell population proliferation
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043130 F ubiquitin binding
GO:0045879 P negative regulation of smoothened signaling pathway
GO:0046872 F metal ion binding
GO:0048749 P compound eye development
RNA-seq EntryA_BomaMSG_c21560_g1_i1
Sequence
(Amino Acid)
RELEVTAHNVYDYVRKYSQHRMLISQEKALEAMRVGVLDVLPESALEGLTAEDLRLLLNG
VGDINVAALVSYTSFNDESGEQPERLARFKRWLWAIVDKMTHLERQDLVYFWTGSPALPA
SEEGFQPMPSVTIRPADDAHLPTANTCISRLYIPLYSSRHVLKHKLLLAIKTKNFGFV
*(58 a.a.)

- SilkBase 1999-2023 -