SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10635_3prime_partial:A_BomaMSG_c21555_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		F-box-like/WD_repeat-containing_protein_TBL1XR1_[Bombyx_mori]
Ontology
GO:0000118 C histone deacetylase complex
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0002021 P response to dietary excess
GO:0003677 F DNA binding
GO:0003714 F transcription corepressor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005876 C spindle microtubule
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0008013 F beta-catenin binding
GO:0010468 P regulation of gene expression
GO:0016042 P lipid catabolic process
GO:0016568 P chromatin organization
GO:0016575 P histone deacetylation
GO:0017053 C transcription repressor complex
GO:0030814 P obsolete regulation of cAMP metabolic process
GO:0035264 P multicellular organism growth
GO:0042393 F histone binding
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0044212 F transcription cis-regulatory region binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0047485 F protein N-terminus binding
GO:0050872 P white fat cell differentiation
GO:0060070 P canonical Wnt signaling pathway
GO:0060612 P adipose tissue development
GO:0060613 P fat pad development
GO:0090207 P regulation of triglyceride metabolic process
RNA-seq EntryA_BomaMSG_c21555_g1_i1
Sequence
(Amino Acid)
MSFTSDEVNFLVYRYLQESGFHHSAYSFGIESHISQSNINGALVPPAALLNIIQKGLQYT
AAEITLGDNGTENRLTESLSLIDAVTPDVVAAKQNAHNAQKQAAKTEQGSGSEQNGVDGT
TCSAQAAASAETPASNIPVPMDMDTSIEIPANKATVLRGHESEVFICAWNPSTDLLASGS
GDSTARIWDMSDNPTTTPNQLVLRHCIQKGGTEVPSNKDVTSLDWNCDGNLLATGSYDGY
ARIWTTDGTLASTLGQHKGPIFALKWNKRGNFILSAGVDKTTIIWDASTGQCTQQFSFHL
APALDVDWQTNTSFASCSTDQCIHVCKLNADKPIKSFQGHTNEVNAIKWDPQGQ
(117 a.a.)

- SilkBase 1999-2023 -