SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10479_internal:A_BomaMSG_c21456_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		serine/threonine-protein_kinase_PAK_3_isoform_X2_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000278 P mitotic cell cycle
GO:0001726 C ruffle
GO:0001934 P positive regulation of protein phosphorylation
GO:0003824 F catalytic activity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0005518 F collagen binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005911 C cell-cell junction
GO:0005925 C focal adhesion
GO:0006468 P protein phosphorylation
GO:0006887 P exocytosis
GO:0006915 P apoptotic process
GO:0007409 P axonogenesis
GO:0008152 P metabolic process
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0023014 P signal transduction
GO:0030036 P actin cytoskeleton organization
GO:0030054 C cell junction
GO:0030335 P positive regulation of cell migration
GO:0031532 P actin cytoskeleton reorganization
GO:0032587 C ruffle membrane
GO:0033138 P positive regulation of peptidyl-serine phosphorylation
GO:0033148 P positive regulation of intracellular estrogen receptor signaling pathway
GO:0042060 P wound healing
GO:0042995 C cell projection
GO:0043234 C protein-containing complex
GO:0043507 P positive regulation of JUN kinase activity
GO:0046777 P protein autophosphorylation
GO:0048754 P branching morphogenesis of an epithelial tube
GO:0051496 P positive regulation of stress fiber assembly
GO:0060244 P negative regulation of cell proliferation involved in contact inhibition
GO:0071437 C obsolete invadopodium
RNA-seq EntryA_BomaMSG_c21456_g1_i1
Sequence
(Amino Acid)
KNGPRFDMSSDEDKPPAPPVRLTSNRATDRVDSVASVDMRPLPKEPDDGSDRKKKTLKAK
IKGSKSTAHNDNKPNISYPTNFEHTVHVGFDAVTGEFTGMPEAWARLLMAANISKQEQKN
NPQAVLDVLKWYDASATQPPPSKYMTSAQMHTTHSGSSVSRVSSSSPSSSTPTDTEHPEP
PPPPPSRPDRTKSIYTKPIEEEEVPPPRPAPAPAAVTTPSSPPPHISHSAVTTHSVCRAE
GGVVSLDRNKNLPAGVPVAPPPAQTNTETGRATG
(90 a.a.)

- SilkBase 1999-2023 -