SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG10445_5prime_partial:A_BomaMSG_c21428_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
serine/threonine-protein_kinase_N_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004697 F protein kinase C activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005856 C cytoskeleton
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006468 P protein phosphorylation
GO:0007049 P cell cycle
GO:0007155 P cell adhesion
GO:0007165 P signal transduction
GO:0007275 P multicellular organism development
GO:0007391 P dorsal closure
GO:0007472 P wing disc morphogenesis
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0030027 C lamellipodium
GO:0030054 C cell junction
GO:0030496 C midbody
GO:0031532 P actin cytoskeleton reorganization
GO:0032154 C cleavage furrow
GO:0035556 P intracellular signal transduction
GO:0042995 C cell projection
GO:0046777 P protein autophosphorylation
GO:0051301 P cell division
GO:0090303 P positive regulation of wound healing
RNA-seq EntryA_BomaMSG_c21428_g1_i1
Sequence
(Amino Acid)
CALPISLMRRLLRKNPERRLGSSERDAEDVKKQAFFRNVDWEQLLLRKVKPPFVPTIKHL
EDVSNFDSEFTSEAAVLTPPKEPRPLSSTDHKMFEDFTYMADWC
*(34 a.a.)

- SilkBase 1999-2023 -