SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomaMSG10404_3prime_partial:A_BomaMSG_c21409_g1_i1
Scaffold_id
NCBI non-redundant
(nr)		aubergine_protein_[Bombyx_mori]
Ontology
GO:0000398 P mRNA splicing, via spliceosome
GO:0001556 P oocyte maturation
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005875 C microtubule associated complex
GO:0006342 P heterochromatin assembly
GO:0006417 P regulation of translation
GO:0006446 P regulation of translational initiation
GO:0007076 P mitotic chromosome condensation
GO:0007275 P multicellular organism development
GO:0007279 P pole cell formation
GO:0007317 P regulation of pole plasm oskar mRNA localization
GO:0007318 P pole plasm protein localization
GO:0010529 P negative regulation of transposition
GO:0016246 P RNA interference
GO:0030154 P cell differentiation
GO:0030423 P targeting of mRNA for destruction involved in RNA interference
GO:0030717 P oocyte karyosome formation
GO:0031047 P gene silencing by RNA
GO:0034584 F piRNA binding
GO:0035282 P segmentation
GO:0043186 C P granule
GO:0045089 P positive regulation of innate immune response
GO:0046011 P regulation of oskar mRNA translation
GO:0046012 P positive regulation of oskar mRNA translation
GO:0046594 P maintenance of pole plasm mRNA location
GO:0046843 P dorsal appendage formation
GO:0048477 P oogenesis
GO:0050829 P defense response to Gram-negative bacterium
GO:0060213 P positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0071011 C precatalytic spliceosome
GO:0071013 C catalytic step 2 spliceosome
RNA-seq EntryA_BomaMSG_c21409_g1_i1
Sequence
(Amino Acid)
MSEPRGRGRARGRAGRGGDGGGPAPRRPGEQAGPSQQSMPPGPRPQPPSGWGPQSSVPPV
RAGVPTPTAQAGRASHRVTPTTHEHPGDIDVQQRMQKLELGPHSSGGGDASSVVGRGSRR
GGGRVLPETISILRTRPEAVTSKKGTSGTPLDLLANYFTVETTPKWGLYQYHVDISPEED
STGVRKALMRVHSKTLGGYLFDGTVLYTVNRLHPDPMELYSDRKTDNERMRILIKLTCEV
SPGDYHYIQIFNIIIRKCFNLLKLQLMGRDYFDPEAKIDIPEFKLQIWPGYKTTINQYED
RLLLVTEIAHKVLRMD
(104 a.a.)

- SilkBase 1999-2023 -