SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomaMSG103_internal:A_BomaMSG_c506_g1_i1
Scaffold_id
NCBI non-redundant
(nr)
PREDICTED:_suppressor_of_hairless_protein,_partial_[Plutella_xylostella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000980 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000982 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001078 F DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001709 P cell fate determination
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005700 C polytene chromosome
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0007219 P Notch signaling pathway
GO:0007252 P I-kappaB phosphorylation
GO:0007275 P multicellular organism development
GO:0007451 P dorsal/ventral lineage restriction, imaginal disc
GO:0007616 P long-term memory
GO:0008356 P asymmetric cell division
GO:0008586 P imaginal disc-derived wing vein morphogenesis
GO:0016360 P sensory organ precursor cell fate determination
GO:0017053 C transcription repressor complex
GO:0030097 P hemopoiesis
GO:0042683 P negative regulation of compound eye cone cell fate specification
GO:0042688 P crystal cell differentiation
GO:0043234 C protein-containing complex
GO:0043565 F sequence-specific DNA binding
GO:0045892 P negative regulation of transcription, DNA-templated
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046331 P lateral inhibition
GO:0048190 P wing disc dorsal/ventral pattern formation
GO:1900087 P positive regulation of G1/S transition of mitotic cell cycle
RNA-seq EntryA_BomaMSG_c506_g1_i1
Sequence
(Amino Acid)
NGHDIGIFNSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRYLHVENG
NFHASSTQWGAFTIHLLDDNESESEEFAVRDGYVHYGSTVKLVCSVTGMALPRLIIRKVD
KQMALLEADDPVSQLHKCAFYMKD
(47 a.a.)

- SilkBase 1999-2023 -